PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040390
Common NameLOC102591436
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 228aa    MW: 26037.6 Da    PI: 5.0003
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040390genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017.2e-3254111260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           dDgy+WrKYGqK+vkgs+fprsYY+Ct+++C v+kkve++  +++v+ei+Y+g Hnh+k
  PGSC0003DMP400040390  54 DDGYTWRKYGQKQVKGSNFPRSYYKCTQQNCLVRKKVECAP-NGQVIEIVYNGAHNHPK 111
                           8****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-2844111IPR003657WRKY domain
PROSITE profilePS5081122.48148112IPR003657WRKY domain
SuperFamilySSF1182904.71E-2550111IPR003657WRKY domain
SMARTSM007743.3E-3453111IPR003657WRKY domain
PfamPF031063.7E-2554110IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MQTPTENVGQ ILNCIESRNN EIPQQEEEYS KKQNQQFEQR GIFSSSISAN NSSDDGYTWR  60
KYGQKQVKGS NFPRSYYKCT QQNCLVRKKV ECAPNGQVIE IVYNGAHNHP KTQHLRRKTT  120
DDIYVVAQEN GSSLWRNDQQ FEYNRDVAGL ERIPPAPVLS DASDPMLSNN INVFESHEIS  180
SKLTIFDAED EDLATQEGNF LGDGINEYEL ETKRRYAFPP HPSFSFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-16541091874Probable WRKY transcription factor 4
2lex_A2e-16541091874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387892e-93AC238789.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0142A20, complete sequence.
GenBankHG9754442e-93HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755172e-93HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015163546.11e-172PREDICTED: probable WRKY transcription factor 33
TrEMBLM1C5491e-171M1C549_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600421e-150(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.21e-26WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]